PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G2456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 317aa    MW: 35519.5 Da    PI: 5.4475
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G2456genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.1e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed++l+  ++++G  +W++ ++  g+ R++k+c++rw +yl
      Gh_D08G2456 16 RGPWSPSEDLRLITFIQKHGHQNWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding52.51.1e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++ +++a++ lG++ W++Ia++++ gRt++++k+ w+++l
      Gh_D08G2456  69 RGNFTKDEEDTIIRAHATLGNK-WSKIASYLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-24766IPR009057Homeodomain-like
PROSITE profilePS5129416.0221163IPR017930Myb domain
SuperFamilySSF466893.11E-2914110IPR009057Homeodomain-like
SMARTSM007171.7E-121565IPR001005SANT/Myb domain
PfamPF002496.1E-151663IPR001005SANT/Myb domain
CDDcd001671.68E-91863No hitNo description
PROSITE profilePS5129424.92264118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2667118IPR009057Homeodomain-like
SMARTSM007174.2E-1568116IPR001005SANT/Myb domain
PfamPF002499.6E-1669114IPR001005SANT/Myb domain
CDDcd001671.01E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGKGRAPCCD KEKVKRGPWS PSEDLRLITF IQKHGHQNWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFTKDEEDTI IRAHATLGNK WSKIASYLPG RTDNEIKNVW NTHLKKRLGS  120
MNGNADKKDE SMATSSSSSC VTSMSSFNDK KTNEAFEMAV VSDKANHGSP SEEPEALSSS  180
SISSNVTNSN QVNVSNPEIQ EGPLFNFTGC YYNTSEEVNK PETAFDIPLE SDLEFWNMLD  240
SLVPFQPEGI QSHNETQCPD FGEAENKWLL YLEQELGLDP KDGGFEAEPL LVPETNGMGT  300
LGHYHNTVQP YEPNSKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-27161184105C-Myb DNA-Binding Domain
1msf_C1e-27161184105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591544e-61AJ459154.1 Gossypium hirsutum partial myb125 gene, clone pGhMYB125.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477022.10.0PREDICTED: myb-related protein Myb4
TrEMBLA0A0D2R4W20.0A0A0D2R4W2_G
STRINGPOPTR_0005s09930.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-76myb domain protein 63